4e2g/4/1:G/1:H

Sequences
>4e2g-a4-m1-cG (length=109) [Search sequence]
FAPAFYDLTEVRSFSPLPGFAQAIQGKNLLNWVRIEPNTEPAHEHPHEQAGVLEGTLELT
IGEETRVLRPGAYTIPGGVRHRARTFEDGCLVLDIFSPPREDYARAEDA
>4e2g-a4-m1-cH (length=109) [Search sequence]
FAPAFYDLTEVRSFSPLPGFAQAIQGKNLLNWVRIEPNTEPAHEHPHEQAGVLEGTLELT
IGEETRVLRPGAYTIPGGVRHRARTFEDGCLVLDIFSPPREDYARAEDA
Structure information
PDB ID 4e2g (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Cupin fold protein Sthe2323 from Sphaerobacter thermophilus
Assembly ID 4
Resolution 1.86Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 108
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID G H
UniProt accession D1C798 D1C798
Species 479434 (Sphaerobacter thermophilus DSM 20745) 479434 (Sphaerobacter thermophilus DSM 20745)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4e2g-a4-m1-cG_4e2g-a4-m1-cH.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4e2g-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4e2g/1/1:B/1:A 4e2g/2/1:D/1:C 4e2g/3/1:E/1:F

[Back to Home]