4e2g/4/1:G/1:H

Sequences

>4e2g-a4-m1-cG (length=109) [Search sequence]

FAPAFYDLTEVRSFSPLPGFAQAIQGKNLLNWVRIEPNTEPAHEHPHEQAGVLEGTLELT IGEETRVLRPGAYTIPGGVRHRARTFEDGCLVLDIFSPPREDYARAEDA

>4e2g-a4-m1-cH (length=109) [Search sequence]

FAPAFYDLTEVRSFSPLPGFAQAIQGKNLLNWVRIEPNTEPAHEHPHEQAGVLEGTLELT IGEETRVLRPGAYTIPGGVRHRARTFEDGCLVLDIFSPPREDYARAEDA

Structure information

PDB ID	4e2g (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Cupin fold protein Sthe2323 from Sphaerobacter thermophilus
Assembly ID	4
Resolution	1.86Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	108
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	G	H
UniProt accession	D1C798	D1C798
Species	479434 (Sphaerobacter thermophilus DSM 20745)	479434 (Sphaerobacter thermophilus DSM 20745)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4e2g-a4-m1-cG_4e2g-a4-m1-cH.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4e2g-assembly4.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4e2g/1/1:B/1:A 4e2g/2/1:D/1:C 4e2g/3/1:E/1:F