4e7p/1/1:A/1:B

Sequences
>4e7p-a1-m1-cA (length=131) [Search sequence]
HMKVLVAEDQSMLRDAMCQLLTLQPDVESVLQAKNGQEAIQLLEKESVDIAILDVEMPVK
TGLEVLEWIRSEKLETKVVVVTTFKRAGYFERAVKAGVDAYVLKERSIADLMQTLHTVLE
GRKEYSPELME
>4e7p-a1-m1-cB (length=131) [Search sequence]
HMKVLVAEDQSMLRDAMCQLLTLQPDVESVLQAKNGQEAIQLLEKESVDIAILDVEMPVK
TGLEVLEWIRSEKLETKVVVVTTFKRAGYFERAVKAGVDAYVLKERSIADLMQTLHTVLE
GRKEYSPELME
Structure information
PDB ID 4e7p (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of receiver domain of putative NarL family response regulator spr1814 from Streptococcus pneumoniae in the presence of the phosphoryl analog beryllofluoride
Assembly ID 1
Resolution 1.892Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 15
Sequence identity between the two chains 1.0
PubMed citation 22521891
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q8DNC2 Q8DNC2
Species 171101 (Streptococcus pneumoniae R6) 171101 (Streptococcus pneumoniae R6)
Function annotation BioLiP:4e7pA BioLiP:4e7pB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4e7p-a1-m1-cA_4e7p-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4e7p-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4e7o/1/1:A/1:B 4hye/1/1:A/1:B
Other dimers with similar sequences but different poses
  • 4zms/1/1:B/1:A 4e7p/2/1:A/2:B 4zmr/1/1:B/1:A
  • [Back to Home]