4ec4/5/1:L/1:E

Sequences
>4ec4-a5-m1-cL (length=107) [Search sequence]
DRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGG
LTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLV
>4ec4-a5-m1-cE (length=108) [Search sequence]
SDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGG
GLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLV
Structure information
PDB ID 4ec4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title XIAP-BIR3 in complex with a potent divalent Smac mimetic
Assembly ID 5
Resolution 3.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 29
Sequence identity between the two chains 1.0
PubMed citation 23166698
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID L E
UniProt accession P98170 P98170
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:4ec4L BioLiP:4ec4E
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4ec4-a5-m1-cL_4ec4-a5-m1-cE.pdb.gz
Full biological assembly
Download: 4ec4-assembly5.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4ec4/1/1:F/1:A 4ec4/2/1:B/1:G 4ec4/3/1:C/1:J 4ec4/4/1:D/1:K
Other dimers with similar sequences but different poses
  • 3cm2/5/1:E/1:G 2opz/1/1:A/1:C 2opz/2/1:B/1:D 3clx/5/1:C/1:A 3clx/6/1:B/2:D 3cm2/1/1:D/2:F 3cm2/2/1:A/3:J 3cm2/3/1:H/1:B 3cm2/4/1:C/1:I 3cm7/1/1:D/1:B 3cm7/2/1:A/2:C 3eyl/1/1:A/1:B
  • 4hy0/3/1:E/1:D 4hy0/1/1:A/1:B 4hy0/2/1:H/1:C 4hy0/4/1:F/1:G
  • 5oqw/1/1:A/1:B 6h6q/1/1:B/1:A
  • [Back to Home]