4ec6/8/1:E/1:F

Sequences
>4ec6-a8-m1-cE (length=108) [Search sequence]
SQSKIDTFGRYFLTYYFSQEKNQENYQSSLRTYVSEKVDISDWKALGKTLKSVNYYGSEQ
TKKGYSVEYLLNVSVDNRSKQKITFEVEPTKNGFLVTTQPKLTDFSFN
>4ec6-a8-m1-cF (length=108) [Search sequence]
SQSKIDTFGRYFLTYYFSQEKNQENYQSSLRTYVSEKVDISDWKALGKTLKSVNYYGSEQ
TKKGYSVEYLLNVSVDNRSKQKITFEVEPTKNGFLVTTQPKLTDFSFN
Structure information
PDB ID 4ec6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Ntf2-like, potential transfer protein TraM from Gram-positive conjugative plasmid pIP501
Assembly ID 8
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 32
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E F
UniProt accession Q8L1C7 Q8L1C7
Species 1351 (Enterococcus faecalis) 1351 (Enterococcus faecalis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4ec6-a8-m1-cE_4ec6-a8-m1-cF.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4ec6-assembly8.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4ec6/1/1:A/1:B 4ec6/1/1:A/1:C 4ec6/1/1:B/1:C 4ec6/2/1:D/1:E 4ec6/2/1:D/1:F 4ec6/2/1:E/1:F 4ec6/7/1:E/1:F

[Back to Home]