4emh/4/1:J/1:K

Sequences
>4emh-a4-m1-cJ (length=58) [Search sequence]
GRPILVELKNGETFNGHLENCDNYNLTLREVIRTPDGDKFFRLPECYIRGNNIKYLRI
>4emh-a4-m1-cK (length=58) [Search sequence]
GRPILVELKNGETFNGHLENCDNYNLTLREVIRTPDGDKFFRLPECYIRGNNIKYLRI
Structure information
PDB ID 4emh (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of SpLsm4
Assembly ID 4
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 23
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID J K
UniProt accession O14352 O14352
Species 284812 (Schizosaccharomyces pombe 972h-) 284812 (Schizosaccharomyces pombe 972h-)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4emh-a4-m1-cJ_4emh-a4-m1-cK.pdb.gz
Full biological assembly
Download: 4emh-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4emh/1/1:A/1:B 4emh/1/1:A/1:C 4emh/1/1:B/1:C 4emh/2/1:D/1:E 4emh/2/1:D/1:F 4emh/2/1:E/1:F 4emh/3/1:G/1:H 4emh/3/1:G/1:I 4emh/3/1:H/1:I 4emh/4/1:J/1:L 4emh/4/1:K/1:L 4emh/5/1:M/1:N 4emh/5/1:M/1:O 4emh/5/1:N/1:O 4emh/6/1:P/1:Q 4emh/6/1:P/1:R 4emh/6/1:Q/1:R 4emh/7/1:T/1:U 4emh/7/1:T/1:V 4emh/7/1:U/1:V 4emh/8/1:W/1:X 4emh/8/1:W/1:Y 4emh/8/1:X/1:Y

[Back to Home]