4eot/1/1:A/1:B

Sequences

>4eot-a1-m1-cA (length=92) [Search sequence]

RFSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESE KCQLQSQVEQLKLEVGRLAKERDLYKEKYEKL

>4eot-a1-m1-cB (length=92) [Search sequence]

FSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEK CQLQSQVEQLKLEVGRLAKERDLYKEKYEKLA

Structure information

PDB ID	4eot (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the MafA homodimer bound to the consensus MARE
Assembly ID	1
Resolution	2.855Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	59
Sequence identity between the two chains	0.989
PubMed citation	23148532

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q8NHW3	Q8NHW3
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:4eotA	BioLiP:4eotB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4eot-a1-m1-cA_4eot-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4eot-assembly1.cif.gz