4ety/7/1:B/1:D

Sequences

>4ety-a7-m1-cB (length=90) [Search sequence]

SLPDITIFPNSSLISQGTFVTVVCSYSDKHDLYNVRLEKDGSTFEKSTEPYKTEDEFEIG PVNETITGHYSCIYSKWSERSKTLELKVIK

>4ety-a7-m1-cD (length=93) [Search sequence]

SLPDITIFPNSSLISQGTFVTVVCSYSDKHDLYNVRLEKDGSTFEKSTEPYKTEDEFEIG PVNETITGHYSCIYSKGITWSERSKTLELKVIK

Structure information

PDB ID	4ety (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of a strand-swapped dimer of Mouse Leukocyte-associated immunoglobulin-like receptor 1 (NYSGRC-006047) Extra Cellular Domain
Assembly ID	7
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	117
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	D
UniProt accession	Q8BG84	Q8BG84
Species	10090 (Mus musculus)	10090 (Mus musculus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4ety-a7-m1-cB_4ety-a7-m1-cD.pdb.gz

Full biological assembly Download: 4ety-assembly7.cif.gz

Similar dimers

Other dimers with similar sequences and structures	4esk/5/1:A/1:C 4esk/5/1:B/1:D 4esk/6/1:A/1:C 4esk/7/1:B/1:D 4ety/5/1:B/1:D
Other dimers with similar sequences but different poses	4ety/5/1:B/1:C 4esk/5/1:A/1:B 4esk/5/1:D/1:C 4ety/5/1:C/1:D 4esk/5/1:A/1:D 4esk/5/1:B/1:C 4ety/5/1:B/1:A