4evx/2/3:B/1:A

Sequences

>4evx-a2-m3-cB (length=89) [Search sequence]

RFSSAIAFIQWQGLSLEYRDRQGNWVIGYGHLTPDETLTFITPDQAEAFLLDDLNSCDIL LQNCLPELNDRFQRETLIALFSIGHQRFL

>4evx-a2-m1-cA (length=92) [Search sequence]

RFSSAIAFIQWQGLSLEYRDRQGNWVIGYGHLTPDETLTFITPDQAEAFLLDDLNSCDIL LQNCLPELNDRFQRETLIALFSIGHQRFLSLI

Structure information

PDB ID	4evx (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of putative phage endolysin from S. enterica
Assembly ID	2
Resolution	1.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	29
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	3	1
Chain ID	B	A
UniProt accession	Q8ZLC6	Q8ZLC6
Species	99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2)	99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4evx-a2-m3-cB_4evx-a2-m1-cA.pdb.gz

Full biological assembly Download: 4evx-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

4evx/3/1:B/1:A 4evx/1/1:B/1:A 4evx/1/2:B/2:A 4evx/2/1:B/1:A 4evx/2/3:B/3:A 4evx/4/2:B/1:A 4evx/1/1:B/2:A 4evx/1/2:B/1:A