4ew7/1/1:A/2:A

Sequences
>4ew7-a1-m1-cA (length=112) [Search sequence]
QSVNKYILSIQDIYKNSPVPVCVRNQSRKIIYANGAFIELFSKEDQPLSGDSYNRYGVEV
FLSSLELECQSLGHGAAFCRRFNFHGEIYQIRENISFDNNEIIVLWQINLFP
>4ew7-a1-m2-cA (length=112) [Search sequence]
QSVNKYILSIQDIYKNSPVPVCVRNQSRKIIYANGAFIELFSKEDQPLSGDSYNRYGVEV
FLSSLELECQSLGHGAAFCRRFNFHGEIYQIRENISFDNNEIIVLWQINLFP
Structure information
PDB ID 4ew7 (database links: RCSB PDB PDBe PDBj PDBsum)
Title The crystal structure of conjugative transfer PAS_like domain from Salmonella enterica subsp. enterica serovar Typhimurium
Assembly ID 1
Resolution 1.67Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 56
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession A0A0F6AW83 A0A0F6AW83
Species 588858 (Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S) 588858 (Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4ew7-a1-m1-cA_4ew7-a1-m2-cA.pdb.gz
Full biological assembly
Download: 4ew7-assembly1.cif.gz

[Back to Home]