4f1e/8/1:O/1:P

Sequences
>4f1e-a8-m1-cO (length=62) [Search sequence]
NLHIQKDNPKIVHAFDMEDLGGKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKK
KE
>4f1e-a8-m1-cP (length=63) [Search sequence]
MINLHIQKDNPKIVHAFDMEDLGGKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLII
KKK
Structure information
PDB ID 4f1e (database links: RCSB PDB PDBe PDBj PDBsum)
Title The Crystal Structure of a Human MitoNEET mutant with Asp 67 replaced by a Gly
Assembly ID 8
Resolution 2.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 105
Sequence identity between the two chains 0.984
PubMed citation 23271805
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID O P
UniProt accession Q9NZ45 Q9NZ45
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:4f1eO BioLiP:4f1eP
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4f1e-a8-m1-cO_4f1e-a8-m1-cP.pdb.gz
Full biological assembly
Download: 4f1e-assembly8.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2qd0/1/1:A/1:B 2qh7/1/1:A/1:B 2r13/1/1:A/2:A 3lpq/1/1:B/1:A 3ree/1/1:A/2:A 4ezf/1/1:B/1:A 4f1e/1/1:A/1:B 4f1e/2/1:D/1:C 4f1e/3/1:E/1:F 4f1e/4/1:G/1:H 4f1e/5/1:I/1:J 4f1e/6/1:L/1:K 4f1e/7/1:M/1:N 4f1e/9/1:Q/1:R 4f28/1/1:A/1:B 4f2c/1/1:B/1:A 6de9/1/1:A/2:A 7p0o/1/1:A/1:B

[Back to Home]