4f2l/2/1:A/2:A

Sequences
>4f2l-a2-m1-cA (length=59) [Search sequence]
SSTIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRINELEHHHHHH
>4f2l-a2-m2-cA (length=59) [Search sequence]
SSTIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRINELEHHHHHH
Structure information
PDB ID 4f2l (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of a regulatory domain of AMPK
Assembly ID 2
Resolution 1.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 39
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P54645 P54645
Species 10116 (Rattus norvegicus) 10116 (Rattus norvegicus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4f2l-a2-m1-cA_4f2l-a2-m2-cA.pdb.gz
Full biological assembly
Download: 4f2l-assembly2.cif.gz

[Back to Home]