4f3r/5/12:B/5:B

Sequences
>4f3r-a5-m12-cB (length=146) [Search sequence]
KPIAIYPGTFDPLTNGHVDIIERALPLFNKIIVACAPTLKLEERVNLIADVLTDERVEVL
PLTGLLVDFAKTHQANFILRGLRAVSDFDYEFQLAHNYQLSPEIETIFLPAREGYSYVSG
TVREIVTLGGDVSPFVPPLVARHLQK
>4f3r-a5-m5-cB (length=146) [Search sequence]
KPIAIYPGTFDPLTNGHVDIIERALPLFNKIIVACAPTLKLEERVNLIADVLTDERVEVL
PLTGLLVDFAKTHQANFILRGLRAVSDFDYEFQLAHNYQLSPEIETIFLPAREGYSYVSG
TVREIVTLGGDVSPFVPPLVARHLQK
Structure information
PDB ID 4f3r (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of phosphopantetheine adenylyltransferase (CBU_0288) from Coxiella burnetii
Assembly ID 5
Resolution 2.25Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 66
Sequence identity between the two chains 1.0
PubMed citation 26033498
Chain information
Chain 1 Chain 2
Model ID 12 5
Chain ID B B
UniProt accession Q83EM7 Q83EM7
Species 227377 (Coxiella burnetii RSA 493) 227377 (Coxiella burnetii RSA 493)
Function annotation BioLiP:4f3rB BioLiP:4f3rB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4f3r-a5-m12-cB_4f3r-a5-m5-cB.pdb.gz
Full biological assembly
Download: 4f3r-assembly5.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4f3r/4/10:C/2:A 4f3r/4/1:A/8:C 4f3r/4/3:A/9:C 4f3r/5/13:B/4:B 4f3r/5/1:B/11:B
Other dimers with similar sequences but different poses
  • 4f3r/5/4:B/5:B 4f3r/1/1:A/2:A 4f3r/1/1:A/3:A 4f3r/1/2:A/3:A 4f3r/2/1:B/4:B 4f3r/2/1:B/5:B 4f3r/2/4:B/5:B 4f3r/3/1:C/6:C 4f3r/3/1:C/7:C 4f3r/3/6:C/7:C 4f3r/4/10:C/8:C 4f3r/4/10:C/9:C 4f3r/4/1:A/2:A 4f3r/4/1:A/3:A 4f3r/4/2:A/3:A 4f3r/4/8:C/9:C 4f3r/5/11:B/12:B 4f3r/5/11:B/13:B 4f3r/5/12:B/13:B 4f3r/5/1:B/4:B 4f3r/5/1:B/5:B
  • 4f3r/5/11:B/5:B 4f3r/5/12:B/4:B 4f3r/5/1:B/13:B
  • [Back to Home]