4f3w/1/1:C/1:D

Sequences
>4f3w-a1-m1-cC (length=119) [Search sequence]
IDWKQLRDKATQVAAGAYAPYSRFPVGAAALVDDGRVVTGCNVENVSYGLALCAECGVVC
ALHATGGGRLVALACVDGRGAPLMPCGRCRQLLFEHGGPELLVDHLAGPRRLGDLLPEP
>4f3w-a1-m1-cD (length=120) [Search sequence]
DIDWKQLRDKATQVAAGAYAPYSRFPVGAAALVDDGRVVTGCNVENVSYGLALCAECGVV
CALHATGGGRLVALACVDGRGAPLMPCGRCRQLLFEHGGPELLVDHLAGPRRLGDLLPEP
Structure information
PDB ID 4f3w (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of cytidine deaminase Cdd from Mycobacterium marinum
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 79
Sequence identity between the two chains 1.0
PubMed citation 25613812
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession B2HDU6 B2HDU6
Species 216594 (Mycobacterium marinum M) 216594 (Mycobacterium marinum M)
Function annotation BioLiP:4f3wC BioLiP:4f3wD
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4f3w-a1-m1-cC_4f3w-a1-m1-cD.pdb.gz
Full biological assembly
Download: 4f3w-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 4f3w/1/1:D/1:B 4f3w/1/1:A/1:C
  • 4f3w/1/1:A/1:D 4f3w/1/1:C/1:B
  • [Back to Home]