4f3w/1/1:D/1:B

Sequences

>4f3w-a1-m1-cD (length=120) [Search sequence]

DIDWKQLRDKATQVAAGAYAPYSRFPVGAAALVDDGRVVTGCNVENVSYGLALCAECGVV CALHATGGGRLVALACVDGRGAPLMPCGRCRQLLFEHGGPELLVDHLAGPRRLGDLLPEP

>4f3w-a1-m1-cB (length=121) [Search sequence]

PDIDWKQLRDKATQVAAGAYAPYSRFPVGAAALVDDGRVVTGCNVENVSYGLALCAECGV VCALHATGGGRLVALACVDGRGAPLMPCGRCRQLLFEHGGPELLVDHLAGPRRLGDLLPE P

Structure information

PDB ID	4f3w (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of cytidine deaminase Cdd from Mycobacterium marinum
Assembly ID	1
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	40
Sequence identity between the two chains	1.0
PubMed citation	25613812

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	B
UniProt accession	B2HDU6	B2HDU6
Species	216594 (Mycobacterium marinum M)	216594 (Mycobacterium marinum M)
Function annotation	BioLiP:4f3wD	BioLiP:4f3wB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4f3w-a1-m1-cD_4f3w-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4f3w-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

4f3w/1/1:C/1:D 4f3w/1/1:A/1:B 4f3w/1/1:A/1:D 4f3w/1/1:C/1:B