4f9k/2/1:D/1:C

Sequences
>4f9k-a2-m1-cD (length=54) [Search sequence]
KGCELYVQLHGIQQVLKDCIVHLCISKPERPKFLREHFEKLEKEENRQILARQK
>4f9k-a2-m1-cC (length=57) [Search sequence]
KGCELYVQLHGIQQVLKDCIVHLCISKPERPKFLREHFEKLEKEENRQILARQKSNS
Structure information
PDB ID 4f9k (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of human cAMP-dependent protein kinase type I-beta regulatory subunit (fragment 11-73), Northeast Structural Genomics Consortium (NESG) Target HR8613A
Assembly ID 2
Resolution 2.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 63
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D C
UniProt accession P31321 P31321
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4f9k-a2-m1-cD_4f9k-a2-m1-cC.pdb.gz
Full biological assembly
Download: 4f9k-assembly2.cif.gz
Similar dimers

[Back to Home]