4faz/1/2:B/2:C

Sequences
>4faz-a1-m2-cB (length=62) [Search sequence]
PFAQIYLIEGRTEEQKRAVIEKVTQAMMEAVGAPKENVRVWIHDVPKENWGIGGVSAKAL
GR
>4faz-a1-m2-cC (length=62) [Search sequence]
PFAQIYLIEGRTEEQKRAVIEKVTQAMMEAVGAPKENVRVWIHDVPKENWGIGGVSAKAL
GR
Structure information
PDB ID 4faz (database links: RCSB PDB PDBe PDBj PDBsum)
Title Kinetic and structural characterization of the 4-oxalocrotonate tautomerase isozymes from Methylibium petroleiphilum
Assembly ID 1
Resolution 1.57Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 70
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID B C
UniProt accession A2SI32 A2SI32
Species 420662 (Methylibium petroleiphilum PM1) 420662 (Methylibium petroleiphilum PM1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4faz-a1-m2-cB_4faz-a1-m2-cC.pdb.gz
Full biological assembly
Download: 4faz-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4faz/1/1:A/2:A 4faz/1/1:B/1:C
Other dimers with similar sequences but different poses
  • 4faz/1/1:B/2:C 4faz/1/1:A/1:B 4faz/1/1:A/2:C 4faz/1/1:C/2:A 4faz/1/1:C/2:B 4faz/1/2:A/2:B
  • [Back to Home]