4fdx/1/3:A/3:B

Sequences
>4fdx-a1-m3-cA (length=61) [Search sequence]
PIIQMNLLEGRTVEQKRNAVAAITEAVVRTLDVRPDQVRILINELGVEHFSVAGQTAAMR
Q
>4fdx-a1-m3-cB (length=64) [Search sequence]
PIIQMNLLEGRTVEQKRNAVAAITEAVVRTLDVRPDQVRILINELGVEHFSVAGQTAAMR
QAAA
Structure information
PDB ID 4fdx (database links: RCSB PDB PDBe PDBj PDBsum)
Title Kinetic and structural characterization of the 4-oxalocrotonate tautomerase isozymes from Methylibium petroleiphilum
Assembly ID 1
Resolution 1.64Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 64
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 3 3
Chain ID A B
UniProt accession A2SL37 A2SL37
Species 420662 (Methylibium petroleiphilum PM1) 420662 (Methylibium petroleiphilum PM1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4fdx-a1-m3-cA_4fdx-a1-m3-cB.pdb.gz
Full biological assembly
Download: 4fdx-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4fdx/1/1:A/1:B 4fdx/1/2:A/2:B
Other dimers with similar sequences but different poses
  • 4fdx/1/2:B/3:B 4fdx/1/1:A/2:A 4fdx/1/1:A/3:A 4fdx/1/1:B/2:B 4fdx/1/1:B/3:B 4fdx/1/2:A/3:A
  • [Back to Home]