4frw/2/1:C/1:B

Sequences

>4frw-a2-m1-cC (length=211) [Search sequence]

GELETSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVS
PAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVLVPPLP
SLNPGPALEEGQGLTLAASCTAEGSPAPSVTWDTEVKGTTSSRSFKHSRSAAVTSEFHLV
PSRSMNGQPLTCVVSHPGLLQDQRITHILHV

>4frw-a2-m1-cB (length=213) [Search sequence]

Structure information

PDB ID	4frw (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of human nectin-4 extracellular fragment D1-D2
Assembly ID	2
Resolution	3.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	54
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	B
UniProt accession	Q96NY8	Q96NY8
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	4frw-a2-m1-cC_4frw-a2-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	4frw-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4frw/1/1:A/2:A 4frw/3/1:D/3:D