4fxe/1/1:C/2:C

Sequences
>4fxe-a1-m1-cC (length=47) [Search sequence]
LMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
>4fxe-a1-m2-cC (length=47) [Search sequence]
LMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
Structure information
PDB ID 4fxe (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the intact E. coli RelBE toxin-antitoxin complex
Assembly ID 1
Resolution 2.7503Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 10
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID C C
UniProt accession P0C079 P0C079
Species 83333 (Escherichia coli K-12) 83333 (Escherichia coli K-12)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4fxe-a1-m1-cC_4fxe-a1-m2-cC.pdb.gz
Full biological assembly
Download: 4fxe-assembly1.cif.gz

[Back to Home]