4fxe/1/2:A/2:B

Sequences
>4fxe-a1-m2-cA (length=68) [Search sequence]
GSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEI
VKERLRNP
>4fxe-a1-m2-cB (length=78) [Search sequence]
GSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEI
VKERLRNPKPVRVTLDEL
Structure information
PDB ID 4fxe (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the intact E. coli RelBE toxin-antitoxin complex
Assembly ID 1
Resolution 2.7503Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 119
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession P0C079 P0C079
Species 83333 (Escherichia coli K-12) 83333 (Escherichia coli K-12)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4fxe-a1-m2-cA_4fxe-a1-m2-cB.pdb.gz
Full biological assembly
Download: 4fxe-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2k29/1/1:A/1:B 4fxe/1/1:A/1:B

[Back to Home]