4fzp/1/1:B/1:A

Sequences
>4fzp-a1-m1-cB (length=80) [Search sequence]
ALDCRERIEKDLEDLEKELMEMKSIKLSDDEEAVVERALNYRDDSVYYLEKGDHITSFGC
ITYAEGLTDSLRMLHRIIEG
>4fzp-a1-m1-cA (length=81) [Search sequence]
NALDCRERIEKDLEDLEKELMEMKSIKLSDDEEAVVERALNYRDDSVYYLEKGDHITSFG
CITYAEGLTDSLRMLHRIIEG
Structure information
PDB ID 4fzp (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the uranyl binding protein complexed with uranyl
Assembly ID 1
Resolution 1.29Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 74
Sequence identity between the two chains 1.0
PubMed citation 24557139
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession O27725 O27725
Species 187420 (Methanothermobacter thermautotrophicus str. Delta H) 187420 (Methanothermobacter thermautotrophicus str. Delta H)
Function annotation BioLiP:4fzpB BioLiP:4fzpA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4fzp-a1-m1-cB_4fzp-a1-m1-cA.pdb.gz
Full biological assembly
Download: 4fzp-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2pmr/1/1:A/2:A 4fzo/1/1:B/1:A

[Back to Home]