4g28/1/1:B/2:B

Sequences
>4g28-a1-m1-cB (length=87) [Search sequence]
GRKLELTKAEDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQ
LRSVKMEQRKLNDQANTLVDLAKTQLE
>4g28-a1-m2-cB (length=87) [Search sequence]
GRKLELTKAEDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQ
LRSVKMEQRKLNDQANTLVDLAKTQLE
Structure information
PDB ID 4g28 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance potassium channel splice variant and EBIO-1
Assembly ID 1
Resolution 1.63Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 71
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B B
UniProt accession P70604 P70604
Species 10116 (Rattus norvegicus) 10116 (Rattus norvegicus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4g28-a1-m1-cB_4g28-a1-m2-cB.pdb.gz
Full biological assembly
Download: 4g28-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1g4y/1/1:B/2:B 4g27/1/1:B/2:B 4j9y/1/1:B/2:B 4j9z/1/1:B/2:B 4qnh/1/1:B/2:B 5wbx/2/1:B/2:B 5wc5/2/1:B/2:B

[Back to Home]