4g2s/1/1:D/1:E

Sequences
>4g2s-a1-m1-cD (length=106) [Search sequence]
PYIVRLLNSSLNGCEFPLLTGRTLFVVGQSDALTASGQLPDIPADSFFIPLDHGGVNFEI
QVDTDATEIILHELKEGNSESRSVQLNTPIQVGELLILIRPESEPW
>4g2s-a1-m1-cE (length=106) [Search sequence]
PYIVRLLNSSLNGCEFPLLTGRTLFVVGQSDALTASGQLPDIPADSFFIPLDHGGVNFEI
QVDTDATEIILHELKEGNSESRSVQLNTPIQVGELLILIRPESEPW
Structure information
PDB ID 4g2s (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a Salmonella type III secretion system protein
Assembly ID 1
Resolution 1.858Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 49
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D E
UniProt accession P41783 P41783
Species 90371 (Salmonella enterica subsp. enterica serovar Typhimurium) 90371 (Salmonella enterica subsp. enterica serovar Typhimurium)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4g2s-a1-m1-cD_4g2s-a1-m1-cE.pdb.gz
Full biological assembly
Download: 4g2s-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4g2s/1/1:A/1:B 4g2s/1/1:A/1:F 4g2s/1/1:B/1:C 4g2s/1/1:C/1:D 4g2s/1/1:E/1:F
Other dimers with similar sequences but different poses
  • 3j1w/1/1:W/1:X 3j1w/1/1:A/1:B 3j1w/1/1:A/1:X 3j1w/1/1:B/1:C 3j1w/1/1:C/1:D 3j1w/1/1:D/1:E 3j1w/1/1:E/1:F 3j1w/1/1:F/1:G 3j1w/1/1:G/1:H 3j1w/1/1:H/1:I 3j1w/1/1:I/1:J 3j1w/1/1:J/1:K 3j1w/1/1:K/1:L 3j1w/1/1:L/1:M 3j1w/1/1:M/1:N 3j1w/1/1:N/1:O 3j1w/1/1:O/1:P 3j1w/1/1:P/1:Q 3j1w/1/1:Q/1:R 3j1w/1/1:R/1:S 3j1w/1/1:S/1:T 3j1w/1/1:T/1:U 3j1w/1/1:U/1:V 3j1w/1/1:V/1:W
  • [Back to Home]