4gdk/1/1:C/1:F

Sequences
>4gdk-a1-m1-cC (length=34) [Search sequence]
MPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLL
>4gdk-a1-m1-cF (length=35) [Search sequence]
HMPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLL
Structure information
PDB ID 4gdk (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Human Atg12~Atg5 Conjugate in Complex with an N-terminal Fragment of Atg16L1
Assembly ID 1
Resolution 2.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 17
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C F
UniProt accession Q676U5 Q676U5
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4gdk-a1-m1-cC_4gdk-a1-m1-cF.pdb.gz
Full biological assembly
Download: 4gdk-assembly1.cif.gz
Similar dimers

[Back to Home]