4gho/1/1:A/2:B

Sequences
>4gho-a1-m1-cA (length=96) [Search sequence]
DVSGTVCLSALPPEATDTLNLIAADGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITP
GARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC
>4gho-a1-m2-cB (length=96) [Search sequence]
DVSGTVCLSALPPEATDTLNLIAADGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITP
GARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC
Structure information
PDB ID 4gho (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure Analysis of Streptomyces aureofaciens Ribonuclease S24A mutant
Assembly ID 1
Resolution 1.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 25
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A B
UniProt accession P05798 P05798
Species 1894 (Kitasatospora aureofaciens) 1894 (Kitasatospora aureofaciens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4gho-a1-m1-cA_4gho-a1-m2-cB.pdb.gz
Full biological assembly
Download: 4gho-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4j5g/3/1:A/2:B 4j5k/3/1:A/2:B
Other dimers with similar sequences but different poses
  • 1rge/1/1:A/1:B 1gmp/1/1:A/1:B 1gmr/1/1:A/1:B 1rgf/1/1:A/1:B 1rgg/1/1:A/1:B 1rgh/1/1:A/1:B
  • [Back to Home]