4gif/1/2:A/3:A

Sequences
>4gif-a1-m2-cA (length=45) [Search sequence]
GGWVSGEEFYMLTRRVLQLETVLEGVVSQIDAVGSKLKMLERKGW
>4gif-a1-m3-cA (length=45) [Search sequence]
GGWVSGEEFYMLTRRVLQLETVLEGVVSQIDAVGSKLKMLERKGW
Structure information
PDB ID 4gif (database links: RCSB PDB PDBe PDBj PDBsum)
Title C-terminal coiled-coil domain of transient receptor potential channel TRPP3 (PKD2L1, Polycystin-L)
Assembly ID 1
Resolution 2.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 37
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID A A
UniProt accession Q9P0L9 Q9P0L9
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4gif-a1-m2-cA_4gif-a1-m3-cA.pdb.gz
Full biological assembly
Download: 4gif-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3te3/1/1:B/1:C 3te3/2/1:D/1:F 3te3/2/1:E/1:F 4gif/1/1:A/2:A 4gif/1/1:A/3:A

[Back to Home]