4gjf/2/1:A/2:A

Sequences
>4gjf-a2-m1-cA (length=86) [Search sequence]
MDDIYKAAVEQLTEEQKNEFKAAFDIFVQGAEDGCISTKELGKVMRMLGQNPTPEELQEM
IDEVDEGTVDFDEFLVMMVRCMKDDS
>4gjf-a2-m2-cA (length=86) [Search sequence]
MDDIYKAAVEQLTEEQKNEFKAAFDIFVQGAEDGCISTKELGKVMRMLGQNPTPEELQEM
IDEVDEGTVDFDEFLVMMVRCMKDDS
Structure information
PDB ID 4gjf (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the amino-terminal domain of human cardiac troponin C mutant L29Q in complex with cadmium
Assembly ID 2
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 30
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P63316 P63316
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4gjf-a2-m1-cA_4gjf-a2-m2-cA.pdb.gz
Full biological assembly
Download: 4gjf-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4gje/2/1:A/2:A 4gjg/2/1:A/2:A
Other dimers with similar sequences but different poses
  • 1wrl/2/1:D/1:C 1wrk/1/1:B/1:A 1wrl/1/1:A/1:B 1wrl/3/1:F/1:E
  • [Back to Home]