4gof/1/1:A/1:B

Sequences
>4gof-a1-m1-cA (length=52) [Search sequence]
MKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETAFGVTVEDSDLAL
>4gof-a1-m1-cB (length=52) [Search sequence]
MKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETAFGVTVEDSDLAL
Structure information
PDB ID 4gof (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the SGTA homodimerization domain with covalent modifications to both C38
Assembly ID 1
Resolution 1.35Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 61
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession O43765 O43765
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4gof-a1-m1-cA_4gof-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4gof-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4god/1/1:B/1:A 4goe/1/1:B/1:A

[Back to Home]