4gv5/2/2:A/2:B

Sequences
>4gv5-a2-m2-cA (length=42) [Search sequence]
YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG
>4gv5-a2-m2-cB (length=42) [Search sequence]
YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG
Structure information
PDB ID 4gv5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title X-ray structure of crotamine, a cell-penetrating peptide from the Brazilian snake Crotalus durissus terrificus
Assembly ID 2
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 20
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession Q9PWF3 Q9PWF3
Species 8732 (Crotalus durissus terrificus) 8732 (Crotalus durissus terrificus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4gv5-a2-m2-cA_4gv5-a2-m2-cB.pdb.gz
Full biological assembly
Download: 4gv5-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4gv5/1/1:A/1:B 4gv5/2/1:A/1:B 4gv5/2/1:C/2:C

[Back to Home]