4h33/1/2:A/4:A

Sequences
>4h33-a1-m2-cA (length=91) [Search sequence]
RSNGLNRFLMIFVLLVIIIPVPMVFIEPEINNYPDALWWAIVTATTVGYGDIVPVTPIGR
ILASIMMLFGIAFIGMITSTITNFFRCKKPT
>4h33-a1-m4-cA (length=91) [Search sequence]
RSNGLNRFLMIFVLLVIIIPVPMVFIEPEINNYPDALWWAIVTATTVGYGDIVPVTPIGR
ILASIMMLFGIAFIGMITSTITNFFRCKKPT
Structure information
PDB ID 4h33 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a voltage-gated K+ channel pore module in a closed state in lipid membranes, tetragonal crystal form
Assembly ID 1
Resolution 3.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 62
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 4
Chain ID A A
UniProt accession Q8Y5K1 Q8Y5K1
Species 169963 (Listeria monocytogenes EGD-e) 169963 (Listeria monocytogenes EGD-e)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4h33-a1-m2-cA_4h33-a1-m4-cA.pdb.gz
Full biological assembly
Download: 4h33-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4h33/1/1:A/3:A 4h33/1/1:A/4:A 4h33/1/2:A/3:A 4h37/1/1:A/1:B 4h37/1/1:A/2:B 4h37/1/1:B/2:A 4h37/1/2:A/2:B

[Back to Home]