4h6p/1/1:B/2:B

Sequences
>4h6p-a1-m1-cB (length=184) [Search sequence]
SPLHFVTLLGSLRKASFNAAVARALPEIAPEGIAITPLGSIGTFPHYSQDVQEEGFPAPV
LTMAQQIATADAVVIVTPEYNYSVPGVLKNAIDWLSAVSPQPLAGKPVALVTASPGMIGG
ARAQYHLRQSLVFLDAYVLNRPEAMIGQVTGKVDAQTLELSDVATREFLARQLDALAALA
RTLS
>4h6p-a1-m2-cB (length=184) [Search sequence]
SPLHFVTLLGSLRKASFNAAVARALPEIAPEGIAITPLGSIGTFPHYSQDVQEEGFPAPV
LTMAQQIATADAVVIVTPEYNYSVPGVLKNAIDWLSAVSPQPLAGKPVALVTASPGMIGG
ARAQYHLRQSLVFLDAYVLNRPEAMIGQVTGKVDAQTLELSDVATREFLARQLDALAALA
RTLS
Structure information
PDB ID 4h6p (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a putative chromate reductase from Gluconacetobacter hansenii, Gh-ChrR, containing a R101A substitution.
Assembly ID 1
Resolution 2.556Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 109
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B B
UniProt accession D5QFC5 D5QFC5
Species 714995 (Novacetimonas hansenii ATCC 23769) 714995 (Novacetimonas hansenii ATCC 23769)
Function annotation BioLiP:4h6pB BioLiP:4h6pB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4h6p-a1-m1-cB_4h6p-a1-m2-cB.pdb.gz
Full biological assembly
Download: 4h6p-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3s2y/1/1:A/2:A 3s2y/1/3:D/4:D 3s2y/2/1:A/2:A 3s2y/3/1:C/1:B 3s2y/3/5:C/5:B 3s2y/4/1:C/1:B 3s2y/5/1:D/2:D 4h6p/1/1:A/2:A 4h6p/2/1:C/1:D 4h6p/2/3:C/3:D 4h6p/3/1:E/1:F 4h6p/3/1:G/1:L 4h6p/4/1:H/1:I 4h6p/4/1:J/1:K 4hs4/1/1:C/1:D 4hs4/1/1:E/2:A 4hs4/1/1:F/2:B 4hs4/1/1:G/1:H 4hs4/2/1:A/4:E 4hs4/3/1:B/4:F 4hs4/4/1:C/1:D 4hs4/5/1:G/1:H
Other dimers with similar sequences but different poses
  • 4h6p/3/1:E/1:G 3s2y/1/3:D/1:A 3s2y/1/4:D/2:A 3s2y/3/1:B/5:B 3s2y/3/1:C/5:C 4h6p/1/1:A/1:B 4h6p/1/2:A/2:B 4h6p/2/1:C/3:C 4h6p/2/1:D/3:D 4h6p/3/1:F/1:L 4h6p/4/1:H/1:J 4h6p/4/1:I/1:K 4hs4/1/1:C/1:E 4hs4/1/1:D/2:A 4hs4/1/1:F/1:G 4hs4/1/1:H/2:B
  • 3s2y/1/4:D/1:A 3s2y/1/3:D/2:A 3s2y/3/1:C/5:B 3s2y/3/5:C/1:B 4h6p/1/1:A/2:B 4h6p/1/1:B/2:A 4h6p/2/1:C/3:D 4h6p/2/1:D/3:C 4h6p/3/1:E/1:L 4h6p/3/1:F/1:G 4h6p/4/1:H/1:K 4h6p/4/1:I/1:J 4hs4/1/1:C/2:A 4hs4/1/1:D/1:E 4hs4/1/1:F/1:H 4hs4/1/1:G/2:B
  • [Back to Home]