4h9d/1/1:B/1:A

Sequences
>4h9d-a1-m1-cB (length=89) [Search sequence]
VEVSEQEVKREKEKARELRRSQWWKNRIARGICHYCGEIFPPEELTDHLVPVVRGGKSTR
GNVVPACKECNNRKKYLLPVEWEEYLDSL
>4h9d-a1-m1-cA (length=95) [Search sequence]
NYFIVEVSEQEVKREKEKARELRRSQWWKNRIARGICHYCGEIFPPEELTDHLVPVVRGG
KSTRGNVVPACKECNNRKKYLLPVEWEEYLDSLES
Structure information
PDB ID 4h9d (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Mn-dependent Gme HNH nicking endonuclease from Geobacter metallireducens GS-15, Northeast Structural Genomics Consortium (NESG) Target GmR87
Assembly ID 1
Resolution 2.599Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 15
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q39X46 Q39X46
Species 269799 (Geobacter metallireducens GS-15) 269799 (Geobacter metallireducens GS-15)
Function annotation BioLiP:4h9dB BioLiP:4h9dA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4h9d-a1-m1-cB_4h9d-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4h9d-assembly1.cif.gz

[Back to Home]