4h9d/1/1:C/1:B

Sequences

>4h9d-a1-m1-cC (length=80) [Search sequence]

REKEKARELRRSQWWKNRIARGICHYCGEIFPPEELTDHLVPVVRGGKSTRGNVVPACKE CNNRKKYLLPVEWEEYLDSL

>4h9d-a1-m1-cB (length=89) [Search sequence]

VEVSEQEVKREKEKARELRRSQWWKNRIARGICHYCGEIFPPEELTDHLVPVVRGGKSTR GNVVPACKECNNRKKYLLPVEWEEYLDSL

Structure information

PDB ID	4h9d (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of Mn-dependent Gme HNH nicking endonuclease from Geobacter metallireducens GS-15, Northeast Structural Genomics Consortium (NESG) Target GmR87
Assembly ID	1
Resolution	2.599Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	41
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	B
UniProt accession	Q39X46	Q39X46
Species	269799 (Geobacter metallireducens GS-15)	269799 (Geobacter metallireducens GS-15)
Function annotation	BioLiP:4h9dC	BioLiP:4h9dB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4h9d-a1-m1-cC_4h9d-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4h9d-assembly1.cif.gz