4hah/3/1:A/1:B

Sequences

>4hah-a3-m1-cA (length=215) [Search sequence]

PSTNKHLKNNFNSLHNQMRKMPVSHFKEALDVPDYSGMRQSGFFAMSQGFQLNNHGYDVF
IHARRESPQSQGKFAGDKFHISVLRDMVPQAFQALSGLLFSEDSPVDKWKVTDMEKVVQQ
ARVSLGAQFTLYIKPDQENSQYSASFLHKTRQFIECLESRLSENGVISGQCPESDVHPEN
WKYLSYRNELRSGRDGGEMQRQALREEPFYRLMTE

>4hah-a3-m1-cB (length=215) [Search sequence]

Structure information

PDB ID	4hah (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of the Salmonella plasmid virulence C protein (SpvC)
Assembly ID	3
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	84
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P0A2M9	P0A2M9
Species	99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2)	99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	4hah-a3-m1-cA_4hah-a3-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	4hah-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2z8m/3/1:A/1:B 4h43/3/1:A/1:B