4har/2/1:D/1:C

Sequences

>4har-a2-m1-cD (length=99) [Search sequence]

TEACVTSWLWSEGEGAVFYRVDLHFTNLGTPPLDEDGRWDPALMYNPCGPEPPAHVVRAY NQPAGDVRGVWGKGERTYAEQDFRVGGTRWHRLLRMPVR

>4har-a2-m1-cC (length=100) [Search sequence]

EACVTSWLWSEGEGAVFYRVDLHFTNLGTPPLDEDGRWDPALMYNPCGPEPPAHVVRAYN QPAGDVRGVWGKGERTYAEQDFRVGGTRWHRLLRMPVRGL

Structure information

PDB ID	4har (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of Rubella virus capsid protein (residues 127-277)
Assembly ID	2
Resolution	2.663Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	156
Sequence identity between the two chains	0.99

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	C
UniProt accession	P08563	P08563
Species	11043 (Rubella virus strain M33)	11043 (Rubella virus strain M33)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4har-a2-m1-cD_4har-a2-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4har-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4har/1/1:B/1:A 4har/3/1:E/1:F 4hbe/1/1:A/1:B 5khe/1/1:A/1:B 5khf/1/1:A/1:B