4har/2/1:D/1:C

Sequences
>4har-a2-m1-cD (length=99) [Search sequence]
TEACVTSWLWSEGEGAVFYRVDLHFTNLGTPPLDEDGRWDPALMYNPCGPEPPAHVVRAY
NQPAGDVRGVWGKGERTYAEQDFRVGGTRWHRLLRMPVR
>4har-a2-m1-cC (length=100) [Search sequence]
EACVTSWLWSEGEGAVFYRVDLHFTNLGTPPLDEDGRWDPALMYNPCGPEPPAHVVRAYN
QPAGDVRGVWGKGERTYAEQDFRVGGTRWHRLLRMPVRGL
Structure information
PDB ID 4har (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Rubella virus capsid protein (residues 127-277)
Assembly ID 2
Resolution 2.663Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 156
Sequence identity between the two chains 0.99
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D C
UniProt accession P08563 P08563
Species 11043 (Rubella virus strain M33) 11043 (Rubella virus strain M33)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4har-a2-m1-cD_4har-a2-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4har-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4har/1/1:B/1:A 4har/3/1:E/1:F 4hbe/1/1:A/1:B 5khe/1/1:A/1:B 5khf/1/1:A/1:B

[Back to Home]