4hbo/2/1:B/3:B

Sequences

>4hbo-a2-m1-cB (length=75) [Search sequence]

ACVTSWLWSEGEGAVFYRVDLHFYNPCGPEPPAHVVRAYNQPAGDVRGVWGKGERTYAEQ DFRVGGTRWHRLLRP

>4hbo-a2-m3-cB (length=75) [Search sequence]

ACVTSWLWSEGEGAVFYRVDLHFYNPCGPEPPAHVVRAYNQPAGDVRGVWGKGERTYAEQ DFRVGGTRWHRLLRP

Structure information

PDB ID	4hbo (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of Rubella virus capsid protein (residues 127-277)
Assembly ID	2
Resolution	3.241Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	98
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	3
Chain ID	B	B
UniProt accession	P08563	P08563
Species	11043 (Rubella virus strain M33)	11043 (Rubella virus strain M33)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4hbo-a2-m1-cB_4hbo-a2-m3-cB.pdb.gz

Full biological assembly Download: 4hbo-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4hbo/1/1:A/2:A 4hbo/3/1:C/4:C 4hbo/4/1:D/5:D 4hbo/5/1:E/4:E