4hcf/3/1:A/2:B

Sequences
>4hcf-a3-m1-cA (length=87) [Search sequence]
AKVIEVELNDDYFNPNVITIPINESTTLLLKNKGKSEHTFTIKKLGIDVVVESGKEKNIT
VKPKSAGTYELICRYHLLKGEGKVIVK
>4hcf-a3-m2-cB (length=95) [Search sequence]
DLAQPIASAKVIEVELNDDYFNPNVITIPINESTTLLLKNKGKSEHTFTIKKLGIDVVVE
SGKEKNITVKPKSAGTYELICRYHLLKGEGKVIVK
Structure information
PDB ID 4hcf (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Uncharacterized Cupredoxin-like Domain Protein Cupredoxin_1 with Copper Bound from Bacillus anthracis
Assembly ID 3
Resolution 1.703Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 28
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A B
UniProt accession A0A6L7H6L8 A0A6L7H6L8
Species 198094 (Bacillus anthracis str. Ames) 198094 (Bacillus anthracis str. Ames)
Function annotation BioLiP:4hcfA BioLiP:4hcfB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4hcf-a3-m1-cA_4hcf-a3-m2-cB.pdb.gz
Full biological assembly
Download: 4hcf-assembly3.cif.gz

[Back to Home]