4hcg/1/1:B/1:A

Sequences

>4hcg-a1-m1-cB (length=89) [Search sequence]

ASAKVIEVELNDDYFNPNVITIPINESTTLLLKNKGKSEHTFTIKKLGIDVVVESGKEKN ITVKPKSAGTYELICRYHLLKGEGKVIVK

>4hcg-a1-m1-cA (length=94) [Search sequence]

LAQPIASAKVIEVELNDDYFNPNVITIPINESTTLLLKNKGKSEHTFTIKKLGIDVVVES GKEKNITVKPKSAGTYELICRYHLLKGEGKVIVK

Structure information

PDB ID	4hcg (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Uncharacterized Cupredoxin-like Domain Protein Cupredoxin_1 with Zinc bound from Bacillus anthracis
Assembly ID	1
Resolution	1.847Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	27
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	A0A6L7H6L8	A0A6L7H6L8
Species	198094 (Bacillus anthracis str. Ames)	198094 (Bacillus anthracis str. Ames)
Function annotation	BioLiP:4hcgB	BioLiP:4hcgA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4hcg-a1-m1-cB_4hcg-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4hcg-assembly1.cif.gz