4hi4/2/1:G/2:A

Sequences
>4hi4-a2-m1-cG (length=119) [Search sequence]
GSHMARIASALDNVSANVMIADNDLNIIYMNRTVSEMLGRAEADIRKQLPNFDAGRLMGA
NIDVFHKNPAHQRHLLANLTGVHKAELNLGGRRFSLDVVPVFNDANARLGSAVQWTDRT
>4hi4-a2-m2-cA (length=119) [Search sequence]
GSHMARIASALDNVSANVMIADNDLNIIYMNRTVSEMLGRAEADIRKQLPNFDAGRLMGA
NIDVFHKNPAHQRHLLANLTGVHKAELNLGGRRFSLDVVPVFNDANARLGSAVQWTDRT
Structure information
PDB ID 4hi4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the 5-coordinate ferric heme-binding PAS domain of Aer2 from P. aeruginosa
Assembly ID 2
Resolution 2.304Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 49
Sequence identity between the two chains 1.0
PubMed citation 23274111
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID G A
UniProt accession Q9I6V6 Q9I6V6
Species 287 (Pseudomonas aeruginosa) 287 (Pseudomonas aeruginosa)
Function annotation BioLiP:4hi4G BioLiP:4hi4A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4hi4-a2-m1-cG_4hi4-a2-m2-cA.pdb.gz
Full biological assembly
Download: 4hi4-assembly2.cif.gz
Similar dimers

[Back to Home]