4hi6/1/3:C/1:B

Sequences
>4hi6-a1-m3-cC (length=136) [Search sequence]
HSYVELKDKVIVPGWPTLMLEIDFVGGTSRNQFLNIPFLSVKEPLQLPREKKLTDYFTID
VEPAGHSLVNIYFQIDDFLLLTLNSLSVYKDPIRKYMFLRLNKEQSKWAINAAFNVFSYR
LRNIGVGPLGPDIRSS
>4hi6-a1-m1-cB (length=137) [Search sequence]
KHSYVELKDKVIVPGWPTLMLEIDFVGGTSRNQFLNIPFLSVKEPLQLPREKKLTDYFTI
DVEPAGHSLVNIYFQIDDFLLLTLNSLSVYKDPIRKYMFLRLNKEQSKWAINAAFNVFSY
RLRNIGVGPLGPDIRSS
Structure information
PDB ID 4hi6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of H112W mutant of borna disease virus matrix protein
Assembly ID 1
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 37
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 3 1
Chain ID C B
UniProt accession P0C794 P0C794
Species 12455 (Borna disease virus) 12455 (Borna disease virus)
Function annotation BioLiP:4hi6B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4hi6-a1-m3-cC_4hi6-a1-m1-cB.pdb.gz
Full biological assembly
Download: 4hi6-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4hi6/1/1:C/2:B 4hi6/1/2:C/3:B 4hit/1/1:A/2:D 4hit/1/1:D/3:A 4hit/1/2:A/3:D
Other dimers with similar sequences but different poses
  • 4hiu/1/2:A/4:A 3f1j/1/1:A/3:A 3f1j/1/1:A/4:A 3f1j/1/2:A/3:A 3f1j/1/2:A/4:A 4hi5/1/1:A/3:A 4hi5/1/1:A/4:A 4hi5/1/2:A/3:A 4hi5/1/2:A/4:A 4hi6/1/1:B/1:A 4hi6/1/1:C/1:B 4hi6/1/1:D/1:A 4hi6/1/1:D/1:C 4hi6/1/2:B/2:A 4hi6/1/2:C/2:B 4hi6/1/2:D/2:A 4hi6/1/2:D/2:C 4hi6/1/3:B/3:A 4hi6/1/3:C/3:B 4hi6/1/3:D/3:A 4hi6/1/3:D/3:C 4hit/1/1:A/1:D 4hit/1/1:B/1:A 4hit/1/1:C/1:B 4hit/1/1:C/1:D 4hit/1/2:A/2:D 4hit/1/2:B/2:A 4hit/1/2:C/2:B 4hit/1/2:C/2:D 4hit/1/3:A/3:D 4hit/1/3:B/3:A 4hit/1/3:C/3:B 4hit/1/3:C/3:D 4hiu/1/1:A/3:A 4hiu/1/1:A/4:A 4hiu/1/2:A/3:A 4hiw/2/1:A/3:A 4hiw/2/1:A/4:A 4hiw/2/2:A/3:A 4hiw/2/2:A/4:A 4hiy/2/1:A/3:A 4hiy/2/1:A/4:A 4hiy/2/2:A/3:A 4hiy/2/2:A/4:A
  • 4hi6/1/2:C/3:C 4hi6/1/1:C/2:C 4hi6/1/1:C/3:C 4hit/1/1:A/2:A 4hit/1/1:A/3:A 4hit/1/2:A/3:A
  • 4hi6/1/3:D/1:A 4hi6/1/1:D/2:A 4hi6/1/2:D/3:A
  • [Back to Home]