4hiu/1/2:A/4:A

Sequences
>4hiu-a1-m2-cA (length=132) [Search sequence]
KHSYVELKDKVIVPGWPTLMLEIDFVNQFLNIPFLSVKEPLQLPAEKKLTDYFTIDVEPA
GHSLVNIYFQIDDFLLLTLNSLSVYKDPIRKYMFLRLNKEQSKHAINAAFNVFSYRLRNI
GVGPLGPDIRSS
>4hiu-a1-m4-cA (length=132) [Search sequence]
KHSYVELKDKVIVPGWPTLMLEIDFVNQFLNIPFLSVKEPLQLPAEKKLTDYFTIDVEPA
GHSLVNIYFQIDDFLLLTLNSLSVYKDPIRKYMFLRLNKEQSKHAINAAFNVFSYRLRNI
GVGPLGPDIRSS
Structure information
PDB ID 4hiu (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of R34/53A mutant of borna disease virus matrix protein
Assembly ID 1
Resolution 3.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 79
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 2 4
Chain ID A A
UniProt accession P0C794 P0C794
Species 12455 (Borna disease virus) 12455 (Borna disease virus)
Function annotation BioLiP:4hiuA BioLiP:4hiuA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4hiu-a1-m2-cA_4hiu-a1-m4-cA.pdb.gz
Full biological assembly
Download: 4hiu-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3f1j/1/1:A/3:A 3f1j/1/1:A/4:A 3f1j/1/2:A/3:A 3f1j/1/2:A/4:A 4hi5/1/1:A/3:A 4hi5/1/1:A/4:A 4hi5/1/2:A/3:A 4hi5/1/2:A/4:A 4hi6/1/1:B/1:A 4hi6/1/1:C/1:B 4hi6/1/1:D/1:A 4hi6/1/1:D/1:C 4hi6/1/2:B/2:A 4hi6/1/2:C/2:B 4hi6/1/2:D/2:A 4hi6/1/2:D/2:C 4hi6/1/3:B/3:A 4hi6/1/3:C/3:B 4hi6/1/3:D/3:A 4hi6/1/3:D/3:C 4hit/1/1:A/1:D 4hit/1/1:B/1:A 4hit/1/1:C/1:B 4hit/1/1:C/1:D 4hit/1/2:A/2:D 4hit/1/2:B/2:A 4hit/1/2:C/2:B 4hit/1/2:C/2:D 4hit/1/3:A/3:D 4hit/1/3:B/3:A 4hit/1/3:C/3:B 4hit/1/3:C/3:D 4hiu/1/1:A/3:A 4hiu/1/1:A/4:A 4hiu/1/2:A/3:A 4hiw/2/1:A/3:A 4hiw/2/1:A/4:A 4hiw/2/2:A/3:A 4hiw/2/2:A/4:A 4hiy/2/1:A/3:A 4hiy/2/1:A/4:A 4hiy/2/2:A/3:A 4hiy/2/2:A/4:A
Other dimers with similar sequences but different poses
  • 4hi6/1/3:C/1:B 4hi6/1/1:C/2:B 4hi6/1/2:C/3:B 4hit/1/1:A/2:D 4hit/1/1:D/3:A 4hit/1/2:A/3:D
  • 4hi6/1/2:C/3:C 4hi6/1/1:C/2:C 4hi6/1/1:C/3:C 4hit/1/1:A/2:A 4hit/1/1:A/3:A 4hit/1/2:A/3:A
  • 4hi6/1/3:D/1:A 4hi6/1/1:D/2:A 4hi6/1/2:D/3:A
    		•

    [Back to Home]