4hkd/1/1:A/1:B

Sequences

>4hkd-a1-m1-cA (length=46) [Search sequence]

DDFDFLKNLSLEELQRLKALDPEREIEELRQRYTAKRQPILDADAK

>4hkd-a1-m1-cB (length=48) [Search sequence]

GADDFDFLKNLSLEELQRLKALDPEREIEELRQRYTAKRQPILDADAK

Structure information

PDB ID	4hkd (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of human MST2 SARAH domain
Assembly ID	1
Resolution	1.503Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	57
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q13188	Q13188
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4hkd-a1-m1-cA_4hkd-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4hkd-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3wws/1/1:B/1:A 3wws/2/1:C/1:D 4hkd/2/1:C/1:D