4hl9/4/1:G/1:H

Sequences

>4hl9-a4-m1-cG (length=91) [Search sequence]

LKVIAQDFIKPEAIDIVLPLYRELVEKTRQEPLLAYDLFVDQKDPGHFVFIEEWPDRAAL DIHATEHFTRLVPLINAHQRQDGTVVLDAVP

>4hl9-a4-m1-cH (length=91) [Search sequence]

LKVIAQDFIKPEAIDIVLPLYRELVEKTRQEPLLAYDLFVDQKDPGHFVFIEEWPDRAAL DIHATEHFTRLVPLINAHQRQDGTVVLDAVP

Structure information

PDB ID	4hl9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of antibiotic biosynthesis monooxygenase
Assembly ID	4
Resolution	1.93Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	50
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	G	H
UniProt accession	Q2RXF1	Q2RXF1
Species	269796 (Rhodospirillum rubrum ATCC 11170)	269796 (Rhodospirillum rubrum ATCC 11170)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4hl9-a4-m1-cG_4hl9-a4-m1-cH.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4hl9-assembly4.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4hl9/1/1:A/1:B 4hl9/2/1:C/1:D 4hl9/3/1:E/1:F 4hl9/5/1:I/2:I