4hob/2/1:D/1:C

Sequences
>4hob-a2-m1-cD (length=60) [Search sequence]
SEEMNLKILAYLGTKQGAKAVHIAQSLGAQRSEVNRHLYRMSEDGRVRKHPQHPVWYLPA
>4hob-a2-m1-cC (length=67) [Search sequence]
HMASNPISEEMNLKILAYLGTKQGAKAVHIAQSLGAQRSEVNRHLYRMSEDGRVRKHPQH
PVWYLPA
Structure information
PDB ID 4hob (database links: RCSB PDB PDBe PDBj PDBsum)
Title The crystal structure of the Zalpha domain from Cyprinid Herpes virus 3
Assembly ID 2
Resolution 1.76Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 80
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D C
UniProt accession A4FTK7 A4FTK7
Species 180230 (Cyprinid herpesvirus 3) 180230 (Cyprinid herpesvirus 3)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4hob-a2-m1-cD_4hob-a2-m1-cC.pdb.gz
Full biological assembly
Download: 4hob-assembly2.cif.gz
Similar dimers

[Back to Home]