4hpk/1/1:A/1:B

Sequences

>4hpk-a1-m1-cA (length=110) [Search sequence]

KLKEKENNDSSDKATVIPNFNTTMQGSLLGDDSRDYYSFEVKEEGEVNIELDKKDEFGVT WTLHPESDRITYGQVDGNKVSNKVKLRPGKYYLLVYKYSGSGNYELRVNK

>4hpk-a1-m1-cB (length=113) [Search sequence]

IPGNEKLKEKENNDSSDKATVIPNFNTTMQGSLLGDDSRDYYSFEVKEEGEVNIELDKKD EFGVTWTLHPESITYGQVDGNKVSNKVKLRPGKYYLLVYKYSGSGNYELRVNK

Structure information

PDB ID	4hpk (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Clostridium histolyticum colg collagenase collagen-binding domain 3B at 1.35 Angstrom resolution in presence of calcium nitrate
Assembly ID	1
Resolution	1.35Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	44
Sequence identity between the two chains	0.982
PubMed citation	23144249

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q9X721	Q9X721
Species	1498 (Hathewaya histolytica)	1498 (Hathewaya histolytica)
Function annotation	BioLiP:4hpkA	BioLiP:4hpkB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4hpk-a1-m1-cA_4hpk-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4hpk-assembly1.cif.gz

Similar dimers