4hx4/1/1:A/1:B

Sequences
>4hx4-a1-m1-cA (length=128) [Search sequence]
TPSMEDYIKQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIGLVLTSKGK
KIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARK
KDLKSIQK
>4hx4-a1-m1-cB (length=128) [Search sequence]
TPSMEDYIKQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIGLVLTSKGK
KIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARK
KDLKSIQK
Structure information
PDB ID 4hx4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of MNTR mutant E11K complexed with Mn2+
Assembly ID 1
Resolution 1.65Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 74
Sequence identity between the two chains 1.0
PubMed citation 23298157
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P54512 P54512
Species 1423 (Bacillus subtilis) 1423 (Bacillus subtilis)
Function annotation BioLiP:4hx4A BioLiP:4hx4B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4hx4-a1-m1-cA_4hx4-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4hx4-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1on1/1/1:A/1:B 1on2/1/1:A/1:B 2ev0/1/1:A/1:B 2ev5/1/1:B/1:A 2ev6/1/1:A/1:B 2f5c/1/1:A/2:A 2f5d/1/1:A/1:B 2f5e/1/1:A/1:B 2f5f/1/1:A/1:B 2hyf/1/1:B/1:A 2hyf/2/1:C/1:D 2hyf/3/1:B/1:A 2hyg/1/1:D/2:D 3r60/1/1:B/1:A 3r61/1/1:A/1:B 4hv5/1/1:A/1:B 4hv6/1/1:A/2:A 4hv6/2/1:B/3:B 4hx7/1/1:A/1:B 4hx8/1/1:B/1:A
Other dimers with similar sequences but different poses
  • 2hyf/3/1:C/2:D 2hyf/3/1:B/1:C
    		•

    [Back to Home]