4i7a/1/1:D/1:E

Sequences

>4i7a-a1-m1-cD (length=87) [Search sequence]

MYLGKVIGTVVSTSKNESLSGTKLLVVARLTEKLIPDGSTQVVVDTVGAGNGEIVIVSCG SSARQSHSVIDAAVVGIVDTVETVNHH

>4i7a-a1-m1-cE (length=87) [Search sequence]

MYLGKVIGTVVSTSKNESLSGTKLLVVARLTEKLIPDGSTQVVVDTVGAGNGEIVIVSCG SSARQSHSVIDAAVVGIVDTVETVNHH

Structure information

PDB ID	4i7a (database links: RCSB PDB PDBe PDBj PDBsum)
Title	GrpN pentameric microcompartment shell protein from Rhodospirillum rubrum
Assembly ID	1
Resolution	3.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	98
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	E
UniProt accession
Species	1036743 (Rhodospirillum rubrum F11)	1036743 (Rhodospirillum rubrum F11)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4i7a-a1-m1-cD_4i7a-a1-m1-cE.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4i7a-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4i7a/1/1:B/1:A 4i7a/1/1:B/1:E 4i7a/1/1:C/1:A 4i7a/1/1:C/1:D