4i88/1/3:B/3:D |
| >4i88-a1-m3-cB (length=114) [Search sequence] |
GIQISGKGFMPISIIEGDQHIKVIAWLPGVNKEDIILNAVGDTLEIRAKRSPLMITESER IIYSEIPEEEEIYRTIKLPATVKEENASAKFENGVLSVILPKAESSIKKGINIE |
| >4i88-a1-m3-cD (length=114) [Search sequence] |
GIQISGKGFMPISIIEGDQHIKVIAWLPGVNKEDIILNAVGDTLEIRAKRSPLMITESER IIYSEIPEEEEIYRTIKLPATVKEENASAKFENGVLSVILPKAESSIKKGINIE |
|
| PDB ID |
4i88 (database links:
RCSB PDB
PDBe
PDBj
PDBsum) |
| Title |
R107G HSP16.5 |
| Assembly ID |
1 |
| Resolution |
2.85Å |
| Method of structure determination |
X-RAY DIFFRACTION |
| Number of inter-chain contacts |
105 |
| Sequence identity between the two chains |
1.0 |
|
|
Chain 1 |
Chain 2 |
| Model ID |
3 |
3 |
| Chain ID |
B |
D |
| UniProt accession |
Q57733 |
Q57733 |
| Species |
243232 (Methanocaldococcus jannaschii DSM 2661) |
243232 (Methanocaldococcus jannaschii DSM 2661) |
|
Switch viewer: [NGL] [JSmol]
|
Dimer structure:
Chain 1 in red;
Chain 2 in blue.
|
Full biological assembly
|
|
| Other dimers with similar sequences and structures |
1shs/1/1:A/1:C 1shs/1/1:B/1:D 1shs/1/1:E/2:F 1shs/1/1:F/3:E 1shs/1/1:G/1:H 1shs/1/2:A/2:C 1shs/1/2:B/2:D 1shs/1/2:E/3:F 1shs/1/2:G/2:H 1shs/1/3:A/3:C 1shs/1/3:B/3:D 1shs/1/3:G/3:H 4eld/1/10:B/10:A 4eld/1/11:B/11:A 4eld/1/12:B/12:A 4eld/1/13:B/13:A 4eld/1/14:B/14:A 4eld/1/15:B/15:A 4eld/1/16:B/16:A 4eld/1/17:B/17:A 4eld/1/18:B/18:A 4eld/1/19:B/19:A 4eld/1/1:B/1:A 4eld/1/20:B/20:A 4eld/1/21:B/21:A 4eld/1/22:B/22:A 4eld/1/23:B/23:A 4eld/1/24:B/24:A 4eld/1/2:B/2:A 4eld/1/3:B/3:A 4eld/1/4:B/4:A 4eld/1/5:B/5:A 4eld/1/6:B/6:A 4eld/1/7:B/7:A 4eld/1/8:B/8:A 4eld/1/9:B/9:A 4i88/1/1:A/1:C 4i88/1/1:B/1:D 4i88/1/1:E/2:F 4i88/1/1:F/3:E 4i88/1/1:G/1:H 4i88/1/2:A/2:C 4i88/1/2:B/2:D 4i88/1/2:E/3:F 4i88/1/2:G/2:H 4i88/1/3:A/3:C 4i88/1/3:G/3:H |
| Other dimers with similar sequences but different poses |
4i88/1/3:A/3:E 1shs/1/1:A/1:B 1shs/1/1:A/1:E 1shs/1/1:B/1:F 1shs/1/1:C/1:G 1shs/1/1:C/2:D 1shs/1/1:D/1:H 1shs/1/1:D/3:C 1shs/1/1:E/1:F 1shs/1/1:G/2:H 1shs/1/1:H/3:G 1shs/1/2:A/2:B 1shs/1/2:A/2:E 1shs/1/2:B/2:F 1shs/1/2:C/2:G 1shs/1/2:C/3:D 1shs/1/2:D/2:H 1shs/1/2:E/2:F 1shs/1/2:G/3:H 1shs/1/3:A/3:B 1shs/1/3:A/3:E 1shs/1/3:B/3:F 1shs/1/3:C/3:G 1shs/1/3:D/3:H 1shs/1/3:E/3:F 4eld/1/10:B/7:A 4eld/1/11:B/5:A 4eld/1/12:B/8:A 4eld/1/13:B/22:A 4eld/1/14:B/23:A 4eld/1/15:B/21:A 4eld/1/16:B/24:A 4eld/1/17:B/14:A 4eld/1/18:B/15:A 4eld/1/19:B/13:A 4eld/1/1:B/10:A 4eld/1/20:B/16:A 4eld/1/21:B/18:A 4eld/1/22:B/19:A 4eld/1/23:B/17:A 4eld/1/24:B/20:A 4eld/1/2:B/11:A 4eld/1/3:B/9:A 4eld/1/4:B/12:A 4eld/1/5:B/2:A 4eld/1/6:B/3:A 4eld/1/7:B/1:A 4eld/1/8:B/4:A 4eld/1/9:B/6:A 4i88/1/1:A/1:B 4i88/1/1:A/1:E 4i88/1/1:B/1:F 4i88/1/1:C/1:G 4i88/1/1:C/2:D 4i88/1/1:D/1:H 4i88/1/1:D/3:C 4i88/1/1:E/1:F 4i88/1/1:G/2:H 4i88/1/1:H/3:G 4i88/1/2:A/2:B 4i88/1/2:A/2:E 4i88/1/2:B/2:F 4i88/1/2:C/2:G 4i88/1/2:C/3:D 4i88/1/2:D/2:H 4i88/1/2:E/2:F 4i88/1/2:G/3:H 4i88/1/3:A/3:B 4i88/1/3:B/3:F 4i88/1/3:C/3:G 4i88/1/3:D/3:H 4i88/1/3:E/3:F
4eld/1/9:B/18:A 4eld/1/10:B/17:A 4eld/1/11:B/19:A 4eld/1/12:B/20:A 4eld/1/13:B/3:A 4eld/1/14:B/4:A 4eld/1/15:B/2:A 4eld/1/16:B/1:A 4eld/1/17:B/9:A 4eld/1/18:B/10:A 4eld/1/19:B/12:A 4eld/1/1:B/15:A 4eld/1/20:B/11:A 4eld/1/21:B/6:A 4eld/1/22:B/5:A 4eld/1/23:B/7:A 4eld/1/24:B/8:A 4eld/1/2:B/16:A 4eld/1/3:B/14:A 4eld/1/4:B/13:A 4eld/1/5:B/21:A 4eld/1/6:B/22:A 4eld/1/7:B/24:A 4eld/1/8:B/23:A |
|