4ic3/1/1:A/1:B

Sequences
>4ic3-a1-m1-cA (length=63) [Search sequence]
EISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQK
ILM
>4ic3-a1-m1-cB (length=64) [Search sequence]
EISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQK
ILMS
Structure information
PDB ID 4ic3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the F495L mutant XIAP RING domain
Assembly ID 1
Resolution 1.783Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 47
Sequence identity between the two chains 1.0
PubMed citation 23259674
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P98170 P98170
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:4ic3A BioLiP:4ic3B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4ic3-a1-m1-cA_4ic3-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4ic3-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4ic2/1/1:A/1:B 5o6t/1/1:B/1:A

[Back to Home]